PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539127.1_FGP003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 298aa    MW: 31628.1 Da    PI: 7.8306
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539127.1_FGP003genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS202.13.2e-62225119274
               GRAS  19 laqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegee 110
                        +a +lL+ l+  ++p gd+ qRl+a+++ AL++r+           p+++ ++  s e+ aa +l+++vsP++ ++   aN aIl+av+g++
  KN539127.1_FGP003   2 AAASLLSALKLSVNPCGDAEQRLVAMMVAALSSRVGT--------GPSQHLADLYSGEHRAACQLLQDVSPCFGLALHGANLAILDAVAGHR 85 
                        68899******************************98........5666666666899999******************************* PP

               GRAS 111 rvHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                        ++H +Dfd+s  +Q +aL++aLa+R+ ++ sl++T+v++p+s      +++l +t erL+k+A++ g++f+f++ v+ r +++e ++L ++p
  KN539127.1_FGP003  86 AIHLVDFDVSA-AQHVALIKALADRRVPATSLKVTVVADPTSPftpaMTQSLAATCERLKKLAQQAGIDFRFRA-VSCRAAEIEASKLGCEP 175
                        *********85.8**************************9988899999*************************.7889************* PP

               GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                        gEalaVnl++ l r++desvs +++rde+L+ v+ l P+vv++veqe+++n+++ ++rf++a  +y a++ds +++
  KN539127.1_FGP003 176 GEALAVNLAFTLSRVPDESVSPANPRDELLRRVRALGPRVVTLVEQELNTNTAPMAARFSDASAHYGAVLDSPSTG 251
                        ************************************************************************8765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098534.6261298IPR005202Transcription factor GRAS
PfamPF035141.1E-592251IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MAAASLLSAL KLSVNPCGDA EQRLVAMMVA ALSSRVGTGP SQHLADLYSG EHRAACQLLQ  60
DVSPCFGLAL HGANLAILDA VAGHRAIHLV DFDVSAAQHV ALIKALADRR VPATSLKVTV  120
VADPTSPFTP AMTQSLAATC ERLKKLAQQA GIDFRFRAVS CRAAEIEASK LGCEPGEALA  180
VNLAFTLSRV PDESVSPANP RDELLRRVRA LGPRVVTLVE QELNTNTAPM AARFSDASAH  240
YGAVLDSPST GKNSLHGAAW STVFRDQCYP ATSALEKGPI RDVSRDKTAT SEWRWHAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-26324722268GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1207750.0AK120775.1 Oryza sativa Japonica Group cDNA clone:J023009G09, full insert sequence.
GenBankAP0041780.0AP004178.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1123_G04.
GenBankAP0058230.0AP005823.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0663F07.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAY2244260.0AY224426.1 Oryza sativa (japonica cultivar-group) isolate 20145 scarecrow transcriptional regulator-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623156.11e-168PREDICTED: scarecrow-like protein 8
TrEMBLA0A0E0NJA01e-168A0A0E0NJA0_ORYRU; Uncharacterized protein
STRINGLOC_Os02g45760.11e-167(Oryza sativa Japonica Group)
STRINGORGLA02G0240700.11e-167(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.11e-56SCARECROW-like 8